DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Ffar4

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_861413.1 Gene:Ffar4 / 107221 MGIID:2147577 Length:361 Species:Mus musculus


Alignment Length:360 Identity:85/360 - (23%)
Similarity:148/360 - (41%) Gaps:53/360 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TGNGSIISVSNSSGNNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLL 90
            ||.|...::...:..::.|.|:  ...||..               ::|.:.....|:|....||
Mouse     9 TGPGPSHTLDQVNRTHFPFFSD--VKGDHRL---------------VLSVVETTVLGLIFVVSLL 56

  Fly    91 GNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIV 155
            || :..||:||.::.|..|..|::||..:|:||. ..:|..........|..|.|.|..:.|::.
Mouse    57 GN-VCALVLVARRRRRGATASLVLNLFCADLLFT-SAIPLVLVVRWTEAWLLGPVVCHLLFYVMT 119

  Fly   156 VTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQY 220
            ::...::.||..:|.:|.:.:|.....:|....|.....:...|......|:|:.:...|...:.
Mouse   120 MSGSVTILTLAAVSLERMVCIVRLRRGLSGPGRRTQAALLAFIWGYSALAALPLCILFRVVPQRL 184

  Fly   221 HGNAGTACVFSTEEEI------W----SLVGFQVSFFLSSYVAPLTLICFLYMGML-------AR 268
            .|.         ::||      |    ..:.:.|.|...:::.|..:|...|..:|       .|
Mouse   185 PGG---------DQEIPICTLDWPNRIGEISWDVFFVTLNFLVPGLVIVISYSKILQITKASRKR 240

  Fly   269 LWKSAPGCKPSAESRKGKR--RVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQII 331
            |..|. ....|.:.|..::  |:.|.:.:::::|.|.|.|| :|.:|..|.......|.:...:.
Mouse   241 LTLSL-AYSESHQIRVSQQDYRLFRTLFLLMVSFFIMWSPI-IITILLILIQNFRQDLVIWPSLF 303

  Fly   332 SHVVAYT--NSCINPILYAFLSDNFRKAFRKVVWC 364
            ..|||:|  ||.:|||||..  ..||..:||:..|
Mouse   304 FWVVAFTFANSALNPILYNM--SLFRNEWRKIFCC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 38/166 (23%)
7tm_1 91..347 CDD:278431 66/276 (24%)
Ffar4NP_861413.1 7tm_1 77..321 CDD:278431 58/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.