DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and zgc:194202

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001122286.1 Gene:zgc:194202 / 100005461 ZFINID:ZDB-GENE-081022-72 Length:295 Species:Danio rerio


Alignment Length:315 Identity:77/315 - (24%)
Similarity:134/315 - (42%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MEY-------DAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLA 117
            |||       .:...:::.:||:.|   .|:....|:.||..|::::....:.||.|..|:.:||
Zfish     1 MEYQNISNMSSSAGPSVDLLVSSAV---LGLCFVLGVPGNIAVLVLLGQYLKDRSFTPKLMFSLA 62

  Fly   118 VSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTS 182
            |||::.::|...:...  :|..|.||...||...|::..:.:|||.::.|:|..|:|.|:||...
Zfish    63 VSDLMSLLFMPVWIYA--LLNGWVFGQALCKLFSYIVYWSLYCSVLSVCLLSVQRYLQVLHPQIW 125

  Fly   183 MSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFF 247
            .:| .|:|.:..|...|..............:|::.:   |....|.....:::...|...|...
Zfish   126 ATL-GEKNQSGMISAIWTLSAALGSYALYYRNVKLMK---NGLLYCYQDYGDDLEKTVVLSVETV 186

  Fly   248 LSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILV 312
            |...|..|:|:|| |.|:..|:.:|.     |..|    .|:|.:.:.:|:.|.|..:|.     
Zfish   187 LMFIVPLLSLLCF-YFGLHRRVSQSV-----SFSS----HRLTTLAIRIVVTFFIFGIPC----- 236

  Fly   313 LKALNLYGGSHLSVIIQIISHVVA------------------YTNSCINPILYAF 349
                             :|:::||                  :.|:.||||||.|
Zfish   237 -----------------MINNIVAIAMPWKSEVNYNATGALFFINNSINPILYTF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 39/156 (25%)
7tm_1 91..347 CDD:278431 66/273 (24%)
zgc:194202NP_001122286.1 7tm_1 36..272 CDD:278431 66/273 (24%)
7tm_4 56..>232 CDD:304433 50/191 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.