DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and cmklr2

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_001343514.2 Gene:cmklr2 / 100004124 ZFINID:ZDB-GENE-091204-457 Length:356 Species:Danio rerio


Alignment Length:337 Identity:90/337 - (26%)
Similarity:154/337 - (45%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DSMEYDAESVALE-------------------RIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQ 103
            |.|:|:.::|..:                   .|:|.|:   :.:....|::|||.||. |...:
Zfish     5 DDMDYENDTVYFDETGYVVDSRSGGYTQREAFHIISVII---YSLAFTLGIIGNGTVIW-VTGFK 65

  Fly   104 QMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPE--WPFGNVWCKFVQYMIVVTCHCSVYTLV 166
            ..||..::.:.|||::|.:||:| :|| :.||||.:  |.||...||...::..:..:.|:..|.
Zfish    66 IKRSINSVWLQNLAIADFVFVLF-LPF-SIDYVLRDFHWLFGKTMCKLNSFVCTMNMYASMLFLT 128

  Fly   167 LMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACV-- 229
            ::|.||:::.||...|...|..|.:.......||.....:.|..:...|.:|    |....|.  
Zfish   129 VLSLDRYVSFVHFSWSQKYRNVRRSWWLCALIWIISCIFSCPALVFRDVILY----NGKIVCFNH 189

  Fly   230 FSTEE------------EIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAES 282
            |..|:            ...::|||.:.|      |.:|:...|    ||...:.:...:.|:.|
Zfish   190 FHDEDRHVMKMRHIGIVSFRTIVGFILPF------ATITVSGVL----LALKMRQSNSVRLSSFS 244

  Fly   283 RKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQI---ISHVVAYTNSCINP 344
                    |||..|:|||.:||.|.|...::: |:::..:.|:.::.|   ::..:|:.|||:||
Zfish   245 --------RMVSAVILAFFVCWAPFHTFSIME-LSVHHSTALNSVLTIGFPLATSLAFFNSCVNP 300

  Fly   345 ILYAFLSDNFRK 356
            |||..|:...||
Zfish   301 ILYVLLTKKVRK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 46/172 (27%)
7tm_1 91..347 CDD:278431 77/274 (28%)
cmklr2XP_001343514.2 7tm_1 54..303 CDD:278431 77/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.