DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TotA and TotC

DIOPT Version :9

Sequence 1:NP_536778.2 Gene:TotA / 44121 FlyBaseID:FBgn0028396 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_536779.2 Gene:TotC / 117462 FlyBaseID:FBgn0044812 Length:129 Species:Drosophila melanogaster


Alignment Length:129 Identity:85/129 - (65%)
Similarity:109/129 - (84%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSSTALMCFALLLISPLCMGYSDEDREADNLRIAEIIKNAQDDDSKINSTQELLDIYRRLYPSL 65
            ||:|.:|:|.|||||||.|:|||||:||:|:||:||||:.:.|.:||||.|||||||:|||.|:|
  Fly     1 MNASISLLCLALLLISPFCLGYSDEERESDSLRVAEIIRTSNDAESKINRTQELLDIFRRLTPTL 65

  Fly    66 TPEERESIDKFVNEHTDAIIIDGVPIQGGRKARIVGKIVSPGVKGLATGFFEELGSKLAQLFTG 129
            :||:||.|::.:.||||.|:|||||.|||||.:.||||:||..:|||.|||||||..|::||||
  Fly    66 SPEQREKIERSIQEHTDEILIDGVPSQGGRKTKYVGKILSPVAQGLAVGFFEELGGSLSRLFTG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TotANP_536778.2 Turandot 41..117 CDD:284622 48/75 (64%)
TotCNP_536779.2 Turandot 41..117 CDD:284622 48/75 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016667
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.