DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and UBC11

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_014984.3 Gene:UBC11 / 854517 SGDID:S000005866 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:84/155 - (54%)
Similarity:113/155 - (72%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MPVKDNHAVSKRLHKELMNLMMANERGISAFP-DGENIFKWVGTIAGPRNTVYSGQTYRLSLDFP 88
            |.|::...|:|||..||:.|:.:....||||| |..::..|||.|.||::|.|||..:::||.||
Yeast     1 MAVEEGGCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFP 65

  Fly    89 NSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQ 153
            .:||:..|::|||:..:|||||..|.|||||||:||||:|:|.|||||:|||||||||.|||||.
Yeast    66 QNYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAV 130

  Fly   154 AAMMWN-DQKEYKKYLDAFYEKHKD 177
            ||.:|: |.:||:|.:.|.||:..|
Yeast   131 AAELWDADMEEYRKKVLACYEEIDD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 77/136 (57%)
UQ_con 36..172 CDD:278603 77/137 (56%)
UBC11NP_014984.3 COG5078 11..156 CDD:227410 81/145 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346482
Domainoid 1 1.000 159 1.000 Domainoid score I864
eggNOG 1 0.900 - - E2759_KOG0421
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5096
Inparanoid 1 1.050 171 1.000 Inparanoid score I1006
Isobase 1 0.950 - 0 Normalized mean entropy S566
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005226
OrthoInspector 1 1.000 - - oto99199
orthoMCL 1 0.900 - - OOG6_104224
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1580
SonicParanoid 1 1.000 - - X3742
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.