DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and UBC20

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_564572.1 Gene:UBC20 / 841471 AraportID:AT1G50490 Length:180 Species:Arabidopsis thaliana


Alignment Length:157 Identity:94/157 - (59%)
Similarity:113/157 - (71%) Gaps:0/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSKHSDDSMPVKDNHAVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTY 81
            |||.........|:.:|.|||..|||.|||....||||||:.:|||.|.|||.|.::||:.|..|
plant    20 GSKQPAAPTKTVDSQSVLKRLQSELMGLMMGGGPGISAFPEEDNIFCWKGTITGSKDTVFEGTEY 84

  Fly    82 RLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNN 146
            ||||.|.|.||:..|.|||.|.|||||||:.|.||||||:||||:.||||||||||||||||||.
plant    85 RLSLSFSNDYPFKPPKVKFETCCFHPNVDVYGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNI 149

  Fly   147 ESPLNAQAAMMWNDQKEYKKYLDAFYE 173
            .||||.|||.:|::|:||:|.::..|:
plant   150 SSPLNTQAAQLWSNQEEYRKMVEKLYK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 88/134 (66%)
UQ_con 36..172 CDD:278603 87/135 (64%)
UBC20NP_564572.1 UQ_con 39..175 CDD:395127 87/135 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 185 1.000 Domainoid score I998
eggNOG 1 0.900 - - E2759_KOG0421
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5096
Inparanoid 1 1.050 202 1.000 Inparanoid score I1303
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1444506at2759
OrthoFinder 1 1.000 - - FOG0005226
OrthoInspector 1 1.000 - - otm3303
orthoMCL 1 0.900 - - OOG6_104224
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3742
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.