DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and UBC19

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_566653.1 Gene:UBC19 / 821545 AraportID:AT3G20060 Length:181 Species:Arabidopsis thaliana


Alignment Length:157 Identity:97/157 - (61%)
Similarity:117/157 - (74%) Gaps:0/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSKHSDDSMPVKDNHAVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTY 81
            |||.|.......|:|:|.|||..|||.|||..:.||||||:.:|||.|.|||.|.::||:.|..|
plant    21 GSKQSAPPTKTVDSHSVLKRLQSELMGLMMGADPGISAFPEEDNIFCWKGTITGSKDTVFEGTEY 85

  Fly    82 RLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNN 146
            ||||.|.|.||:.:|.|||.|.||||||||.|.||||||:||||:.||||||||||||||||||.
plant    86 RLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNI 150

  Fly   147 ESPLNAQAAMMWNDQKEYKKYLDAFYE 173
            .||||.|||.:|::|:||:|.::..|:
plant   151 SSPLNNQAAQLWSNQEEYRKMVEKLYK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 90/134 (67%)
UQ_con 36..172 CDD:278603 88/135 (65%)
UBC19NP_566653.1 UQ_con 40..176 CDD:395127 88/135 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 185 1.000 Domainoid score I998
eggNOG 1 0.900 - - E2759_KOG0421
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5096
Inparanoid 1 1.050 202 1.000 Inparanoid score I1303
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1444506at2759
OrthoFinder 1 1.000 - - FOG0005226
OrthoInspector 1 1.000 - - otm3303
orthoMCL 1 0.900 - - OOG6_104224
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3742
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.