DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and UBE2I

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_005255597.1 Gene:UBE2I / 7329 HGNCID:12485 Length:184 Species:Homo sapiens


Alignment Length:107 Identity:43/107 - (40%)
Similarity:58/107 - (54%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PDGE-NIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDI 119
            |||. |:..|...|.|.:.|.:.|..::|.:.|.:.||.:.|..||....|||||...|.:||.|
Human    32 PDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSI 96

  Fly   120 L-KDK-WSALYDVRTILLSIQSLLGEPNNESPLNAQA-AMMW 158
            | :|| |.....::.|||.||.||.|||.:.|..|:| .:.|
Human    97 LEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYW 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 43/107 (40%)
UQ_con 36..172 CDD:278603 43/107 (40%)
UBE2IXP_005255597.1 COG5078 1..137 CDD:227410 42/104 (40%)
UQ_con 8..137 CDD:278603 42/104 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.