DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and UBE2G1

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_003333.1 Gene:UBE2G1 / 7326 HGNCID:12482 Length:170 Species:Homo sapiens


Alignment Length:158 Identity:51/158 - (32%)
Similarity:84/158 - (53%) Gaps:16/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LHKELMNLMMANERGISA-FPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKF 100
            |.::|..|......|.|| ..|..::::|...|.||.:|:|.|..::..|.||..||...|.:||
Human    10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKF 74

  Fly   101 LTSCFHPNVDLQGAICLDIL-------------KDKWSALYDVRTILLSIQSLLGEPNNESPLNA 152
            :|..:|||||..|.:|:.||             :::|..::.|.||::|:.|:|.:||.:||.|.
Human    75 ITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANV 139

  Fly   153 QAAMMWNDQK--EYKKYLDAFYEKHKDT 178
            .||..|.:.:  |:|:.:.....|.::|
Human   140 DAAKEWREDRNGEFKRKVARCVRKSQET 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 48/144 (33%)
UQ_con 36..172 CDD:278603 49/150 (33%)
UBE2G1NP_003333.1 UQ_con 10..161 CDD:395127 49/150 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.