DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and ube2wb

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001038758.2 Gene:ube2wb / 692325 ZFINID:ZDB-GENE-050113-1 Length:151 Species:Danio rerio


Alignment Length:158 Identity:49/158 - (31%)
Similarity:73/158 - (46%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AVSKRLHKELMNL-------MMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPN 89
            ::.|||.|||:.|       |..||:.:.     ..|.:|:..:.|...|||.|:.::|...|.:
Zfish     3 SMQKRLQKELLALQNDPPPGMTLNEKSVQ-----NTITQWIVDMEGASGTVYEGEKFQLLFKFSS 62

  Fly    90 SYPYAAPVVKFLTSCF--HPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLG--EPNNESPL 150
            .||..:|.|.|.....  ||:|...|.|||.||.:.||....|:::.|||.|:|.  :.....|.
Zfish    63 RYPSDSPQVMFTGDNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPD 127

  Fly   151 NAQAAMMWNDQKEYKKYLDAFYEKHKDT 178
            |:......|...:..|:   :|  |.||
Zfish   128 NSFYVRTCNKNPKKTKW---WY--HDDT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 44/144 (31%)
UQ_con 36..172 CDD:278603 44/146 (30%)
ube2wbNP_001038758.2 UQ_con 7..148 CDD:278603 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.