DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and ube2c

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001032780.1 Gene:ube2c / 566441 ZFINID:ZDB-GENE-051030-48 Length:171 Species:Danio rerio


Alignment Length:172 Identity:103/172 - (59%)
Similarity:131/172 - (76%) Gaps:4/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQNISPEQSGGAGGGGSKHSDDSMPVKDNHAVSKRLHKELMNLMMANERGISAFPDGENIFKWVG 66
            :||:.|..:..|...||:.|    ......:|||||.:|||.|||:.::||||||:.:|:|||:|
Zfish     3 SQNMDPAAASTATLKGSETS----VTASKGSVSKRLQQELMTLMMSGDKGISAFPESDNLFKWIG 63

  Fly    67 TIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVR 131
            ||.|.:.|||.|..|:|||:||:.|||.||.|||:|:|||||||..|.|||||||||||||||||
Zfish    64 TIDGAQGTVYEGLRYKLSLEFPSGYPYNAPRVKFITACFHPNVDENGIICLDILKDKWSALYDVR 128

  Fly   132 TILLSIQSLLGEPNNESPLNAQAAMMWNDQKEYKKYLDAFYE 173
            :||||||||||||||:||:|:.||.||:||:.:|.:|.|.|:
Zfish   129 SILLSIQSLLGEPNNDSPMNSTAAEMWDDQEAFKAHLHATYK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 92/134 (69%)
UQ_con 36..172 CDD:278603 92/135 (68%)
ube2cNP_001032780.1 UQ_con 33..169 CDD:306648 92/135 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595867
Domainoid 1 1.000 201 1.000 Domainoid score I2955
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5096
Inparanoid 1 1.050 212 1.000 Inparanoid score I3622
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1444506at2759
OrthoFinder 1 1.000 - - FOG0005226
OrthoInspector 1 1.000 - - oto39910
orthoMCL 1 0.900 - - OOG6_104224
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1580
SonicParanoid 1 1.000 - - X3742
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.