DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and ube2ka

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001013500.1 Gene:ube2ka / 541355 ZFINID:ZDB-GENE-050320-48 Length:200 Species:Danio rerio


Alignment Length:165 Identity:57/165 - (34%)
Similarity:84/165 - (50%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NHAVS--KRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYP 92
            |.||.  ||..||::.....::..|......||..:..|.||||.:|.|.|..|:|.:..|.:||
Zfish     3 NIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYP 67

  Fly    93 YAAPVVKFLTSCFHPNV-DLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNA---- 152
            :..|.|:|:|..:|||: .:.|||||||||.:|:|...:||:|||:|:||.....:.|.:|    
Zfish    68 FNPPKVRFITKIWHPNISSVTGAICLDILKGQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAN 132

  Fly   153 ----------QAAMMWN--------DQKEYKKYLD 169
                      |.|.:|:        ...||.:.:|
Zfish   133 QYKQNPEMFKQTARLWSHVCAGAPVSSPEYTRKID 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 55/159 (35%)
UQ_con 36..172 CDD:278603 53/157 (34%)
ube2kaNP_001013500.1 COG5078 1..148 CDD:227410 53/144 (37%)
UBCc 6..148 CDD:238117 51/141 (36%)
UBA_like_SF 163..200 CDD:304366 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.