DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and Ube2u

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006238505.1 Gene:Ube2u / 500511 RGDID:1565480 Length:337 Species:Rattus norvegicus


Alignment Length:139 Identity:49/139 - (35%)
Similarity:74/139 - (53%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HAVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAA 95
            :::.:|..|||.|   :..:||:|:|...::..|...|.|.:.:|..|..:.|::||...|....
  Rat    16 YSLLEREFKELQN---SRSKGINAYPVSSDLMSWKAEIEGLKYSVCEGLVFHLTIDFSQDYNLVP 77

  Fly    96 PVVKFLTSCFHPNV-DLQGAICLDIL--KDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAA-M 156
            |||||:|..||||| ...|...|.||  .|.|...|.:..||..:|.||..|..::|||.:|| :
  Rat    78 PVVKFVTIPFHPNVHPYTGQPSLGILDKPDMWDTSYTILRILFDLQMLLSYPMVKNPLNLEAAEL 142

  Fly   157 MWNDQKEYK 165
            :..|:..|:
  Rat   143 LVKDESLYR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 49/139 (35%)
UQ_con 36..172 CDD:278603 49/134 (37%)
Ube2uXP_006238505.1 COG5078 13..156 CDD:227410 49/139 (35%)
UBCc 16..156 CDD:238117 49/139 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.