DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and ube2na

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_998651.1 Gene:ube2na / 406807 ZFINID:ZDB-GENE-040426-2873 Length:154 Species:Danio rerio


Alignment Length:124 Identity:59/124 - (47%)
Similarity:76/124 - (61%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVK 99
            :|:.||...|:.....||.|.||..|...:...||||:::.:.|.|::|.|..|..||.|||.|:
Zfish     6 RRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR 70

  Fly   100 FLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMW 158
            |:|..:|||||..|.|||||||||||....:||:|||||:||..||.:.||....|..|
Zfish    71 FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 59/124 (48%)
UQ_con 36..172 CDD:278603 59/123 (48%)
ube2naNP_998651.1 UBCc 4..151 CDD:412187 59/124 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.