DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and CG7656

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:174 Identity:57/174 - (32%)
Similarity:84/174 - (48%) Gaps:24/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGGSKHSDDSMPVKDNHAVSKRLHKELMNLMMANERGISAFP----DGENIFKWVGTIAGPRNTV 75
            |.||..:..|.........|..:....|......|..:..|.    :.:|:|:|...|.||.:|:
  Fly    20 GSGSLATSSSAAAPTTTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTL 84

  Fly    76 YSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILK-------------DKWSAL 127
            |.|..::..:.||:.|||:.|.::|||..:||||...|.:|:.||.             ::|:..
  Fly    85 YQGGYFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPT 149

  Fly   128 YDVRTILLSIQSLLGEPNNESPLNAQAAMM---WNDQK----EY 164
            .:|||||||:.|||.|||..||.|..|::|   |.|.:    ||
  Fly   150 QNVRTILLSVISLLNEPNTFSPANVDASVMYRRWRDSQGKDNEY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 53/158 (34%)
UQ_con 36..172 CDD:278603 52/153 (34%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 49/143 (34%)
COG5078 45..182 CDD:227410 48/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.