DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and Ubc2

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:188 Identity:64/188 - (34%)
Similarity:90/188 - (47%) Gaps:26/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQNIS----------PEQSGG-------------AGGGGSKHSDDSMPVKDNHAV---SKRLHKE 40
            |.|:|          |:..||             ||||.....:.....:.:.|:   :||:.||
  Fly    30 ASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGGGDEPRKEAKTTPRISRALGTSAKRIQKE 94

  Fly    41 LMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCF 105
            |..:.:......||.|.|:|:::||.||.||..:||.|..:.|.:.|...||:..|.|.|.|..:
  Fly    95 LAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIY 159

  Fly   106 HPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWNDQKE 163
            |.|::.||.||||||||.||....:..:||||.|||.:.|...||....|..:...:|
  Fly   160 HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNRE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 54/136 (40%)
UQ_con 36..172 CDD:278603 52/128 (41%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 53/132 (40%)
UQ_con 90..227 CDD:278603 52/128 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.