DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and CG5440

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:164 Identity:62/164 - (37%)
Similarity:85/164 - (51%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SDDSMP----VKDNHAVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTY 81
            ::|..|    ...|.|| ||:.|||..:.....:..||.|..:|:::|..||.||.::||....:
  Fly     7 AEDGTPSCSWTCSNSAV-KRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIF 70

  Fly    82 RLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNN 146
            :|.:.||..||:|.|||.|.|..:|.|:...|.|||||||:|||....:..|||||.|||.:.|.
  Fly    71 KLDIFFPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNP 135

  Fly   147 ESPLNA--------------QAAMMWNDQKEYKK 166
            :.||.|              :.|.:|.  |.|.|
  Fly   136 KDPLMAKIGTEYLKNRAEHDKKARLWT--KRYAK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 58/148 (39%)
UQ_con 36..172 CDD:278603 56/145 (39%)
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 60/152 (39%)
UQ_con 25..162 CDD:278603 52/136 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.