DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and lwr

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster


Alignment Length:119 Identity:44/119 - (36%)
Similarity:66/119 - (55%) Gaps:4/119 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PDGE-NIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDI 119
            |||. |:..|...|.|.::|.:.|..|:|.:.|.:.||.:.|..||....|||||...|.:||.:
  Fly    32 PDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSL 96

  Fly   120 LKDK--WSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMW-NDQKEYKKYLDA 170
            |.::  |.....::.|||.||.||.|||.:.|..|:|..:: .::.||:|.:.|
  Fly    97 LDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRVRA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 42/113 (37%)
UQ_con 36..172 CDD:278603 44/119 (37%)
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 44/119 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.