DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and ben

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:127 Identity:55/127 - (43%)
Similarity:77/127 - (60%) Gaps:0/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAP 96
            ::.:|:.||...||.....||:|.||..|...:...:.||.::.:.|..::|.|..|..||.:||
  Fly     3 SLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAP 67

  Fly    97 VVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMW 158
            .|:|:|..:|||:|..|.||||:||||||....:||||||||:||..||.:.||....|.:|
  Fly    68 KVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 55/127 (43%)
UQ_con 36..172 CDD:278603 55/123 (45%)
benNP_001162752.1 UBCc 3..149 CDD:412187 55/127 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.