DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and CG2924

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster


Alignment Length:256 Identity:51/256 - (19%)
Similarity:91/256 - (35%) Gaps:98/256 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GGAGGGGSKH------------------------SDDSMPVK--DNHAVSKRLHKELMNL----- 44
            |||||||..|                        .|:.:|::  |..:.||:...|:.:|     
  Fly   139 GGAGGGGGPHGNEETDSDQEEIEDPIGESEQESEGDEDLPLEMDDVRSTSKKDDMEVEHLATLEK 203

  Fly    45 -----------------MMANERGISAFPD-----------------GENIFKWVGTI--AGPRN 73
                             :.|.:|.:....|                 .|:|::|...:  ..|.:
  Fly   204 LRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDS 268

  Fly    74 TVYSG----------QTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVD-----LQGAICLDIL-KD 122
            .::|.          .:..|::.|..:||:..|.|:.:    ||.:.     :.||||:::| |.
  Fly   269 PLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRVV----HPIISGGYVLIGGAICMELLTKQ 329

  Fly   123 KWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWNDQKEYK--------KYLDAFYEKH 175
            .||:.|.|..:::.|.:.|.:........|..|:   .|.:|.        |.|...:||:
  Fly   330 GWSSAYTVEAVIMQIAATLVKGKARIQFGATKAL---TQGQYSLARAQQSFKSLVQIHEKN 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 36/199 (18%)
UQ_con 36..172 CDD:278603 36/200 (18%)
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.