DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and Ube2c

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001100012.1 Gene:Ube2c / 296368 RGDID:1305382 Length:179 Species:Rattus norvegicus


Alignment Length:185 Identity:105/185 - (56%)
Similarity:120/185 - (64%) Gaps:27/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQNISP------------EQSGGAGGGGSKHSDDSMPVKDNHAVSKRLHKELMNLMMANERGISA 54
            :||..|            |..|||..|               .|.|||.:|||.|||:.::||||
  Rat     3 SQNRDPAAASVAAVRKGAEPCGGAARG---------------PVGKRLQQELMTLMMSGDKGISA 52

  Fly    55 FPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDI 119
            ||:.:|:|||||||.|...|||....|:|||:||:.|||.||.|||||.|:|||||.||.|||||
  Rat    53 FPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDI 117

  Fly   120 LKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWNDQKEYKKYLDAFYEK 174
            ||||||||||||||||||||||||||.|||||..||.:|.:...:||||...|.|
  Rat   118 LKDKWSALYDVRTILLSIQSLLGEPNIESPLNTHAAELWKNPTAFKKYLQETYSK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 91/134 (68%)
UQ_con 36..172 CDD:278603 93/135 (69%)
Ube2cNP_001100012.1 COG5078 33..172 CDD:227410 95/138 (69%)
UQ_con 34..170 CDD:278603 93/135 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353711
Domainoid 1 1.000 199 1.000 Domainoid score I2972
eggNOG 1 0.900 - - E2759_KOG0421
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5096
Inparanoid 1 1.050 206 1.000 Inparanoid score I3642
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1444506at2759
OrthoFinder 1 1.000 - - FOG0005226
OrthoInspector 1 1.000 - - oto96087
orthoMCL 1 0.900 - - OOG6_104224
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3742
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.