DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and ubc-22

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_509501.2 Gene:ubc-22 / 182322 WormBaseID:WBGene00006717 Length:182 Species:Caenorhabditis elegans


Alignment Length:152 Identity:38/152 - (25%)
Similarity:63/152 - (41%) Gaps:37/152 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLT- 102
            ::|..:.|.||.      |.:..|.    ||||.:|.|....:.:.|.||::||.|.|.:||.| 
 Worm    16 QQLYIIEMVNEE------DKKITFH----IAGPADTPYETGVFEVDLTFPDNYPNALPQIKFQTL 70

  Fly   103 --SC-FHPN---VDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWN-- 159
              :| ..|:   |.::....|::.:    ||..:..:..||:.      :|..:..:.|..|.  
 Worm    71 IWNCAVEPSTGQVHIENYSRLNVSE----ALSYIEDLFRSIEV------DEEVMFYKTARFWTTE 125

  Fly   160 --------DQKEYKKYLDAFYE 173
                    |....||.:|:..|
 Worm   126 FAGGRPLPDDDWQKKKVDSLIE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 34/143 (24%)
UQ_con 36..172 CDD:278603 37/149 (25%)
ubc-22NP_509501.2 UBCc 5..128 CDD:294101 33/131 (25%)
UBA_like_SF 139..174 CDD:304366 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.