DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vih and ube2c

DIOPT Version :9

Sequence 1:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001095283.1 Gene:ube2c / 100124324 XenbaseID:XB-GENE-971108 Length:179 Species:Xenopus tropicalis


Alignment Length:184 Identity:103/184 - (55%)
Similarity:125/184 - (67%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQNISP-----------EQSGGAGGGGSKHSDDSMPVKDNHAVSKRLHKELMNLMMANERGISAF 55
            :||:.|           ::||.:...||              |.|||.:|||.|||:.::|||||
 Frog     3 SQNVDPAAASSVTARKGQESGTSAARGS--------------VGKRLQQELMTLMMSGDKGISAF 53

  Fly    56 PDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDIL 120
            |:.:|:|||:|||.|...|||....|:|||:||:.|||.||.|||:|.|||||||..|.||||||
 Frog    54 PESDNLFKWIGTIDGAVGTVYESLRYKLSLEFPSGYPYNAPTVKFVTPCFHPNVDSHGNICLDIL 118

  Fly   121 KDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWNDQKEYKKYLDAFYEK 174
            ||||||||||||||||:||||||||||||||..||.:|.:|..|||:|...|:|
 Frog   119 KDKWSALYDVRTILLSLQSLLGEPNNESPLNPYAAELWQNQTAYKKHLHEQYQK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vihNP_648582.1 COG5078 31..166 CDD:227410 91/134 (68%)
UQ_con 36..172 CDD:278603 92/135 (68%)
ube2cNP_001095283.1 UQ_con 34..170 CDD:365926 92/135 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 200 1.000 Domainoid score I2997
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5096
Inparanoid 1 1.050 208 1.000 Inparanoid score I3601
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1444506at2759
OrthoFinder 1 1.000 - - FOG0005226
OrthoInspector 1 1.000 - - oto102821
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3742
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.