DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bgm and CG11659

DIOPT Version :9

Sequence 1:NP_001285923.1 Gene:bgm / 44117 FlyBaseID:FBgn0027348 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_650829.1 Gene:CG11659 / 42352 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster


Alignment Length:498 Identity:92/498 - (18%)
Similarity:172/498 - (34%) Gaps:143/498 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QVAKAFIKLGLEEHHSVGVL----------AFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQH 142
            ::|.....|||.:...||::          |:.|   |::.: |.|:..|      |...|.::.
  Fly    68 RLASYMRSLGLLQSDIVGLIGRNTTHMLAVAYAC---FFNGI-AFHSLNI------TYDRDTIEK 122

  Fly   143 VLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKEDGYYRWSEIESMNVSDV 207
            :.:.:...|:..|.    |:...:|....:|...|...              |...::|:.:.:|
  Fly   123 IYKVTRPSIIFCDG----DEFEKVRSATAELDVKIVTM--------------RNHPLDSIKIDEV 169

  Fly   208 -----EDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGAESI 267
                 |:.:.........::...::.:|||.|.||.|.:::..                      
  Fly   170 VATPIEENFQPAKLEKGNDQTLAILCSSGTTGTPKAVTITNSR---------------------- 212

  Fly   268 VSYLPLSHVAA-----QTVDIY----TCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRV 323
                   |:.|     .|.|:.    |..::.|.:..........|.:.:.....|...:   |:
  Fly   213 -------HILAGNYHLTTADVQYSHNTLDWITGLLTTITSGVFSTTRIIADNAFDPAFAL---RI 267

  Fly   324 YEKFQERMVAVASSSGSLKKM--------LASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSK 380
            .|:::........||.:|...        |:|      |:.||....:::...:..|...|..:.
  Fly   268 IEEYKVTWTIQPPSSMALMINCPDFETCDLSS------LRCYMFGGSRAALEVQKGIRSRLSHNC 326

  Fly   381 VKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTL 445
            ::...||..:                             |...|..||   ..:..|  ::|:.:
  Fly   327 LQFVYGFTEL-----------------------------GAMATINCH---FDEKTG--SVGQLV 357

  Fly   446 PGCESKFINKDANG-----HGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYV 505
            .|.:.|..|.|...     .||:||.....:.||..|:.:|....|...|.||||||::|..|::
  Fly   358 NGLKMKIKNDDGESLGPDEIGEVCIMNNQHWSGYYGNEVETRNMRDSLGWYHSGDLGYMDRDGFL 422

  Fly   506 SLTGRSKEIIITAGGENIP--PVHIENTIKKELDAISNAFLVG 546
            .:..|.||::   ..:||.  |..||:.| .|:..::...:.|
  Fly   423 YIMDRKKEML---KYQNIMYYPNDIESVI-SEMPQVAEVCVFG 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bgmNP_001285923.1 FAA1 32..666 CDD:223953 92/498 (18%)
ACSBG_like 69..665 CDD:213299 92/498 (18%)
CG11659NP_650829.1 CaiC 26..523 CDD:223395 92/498 (18%)
AFD_class_I 47..522 CDD:302604 92/498 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.