DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and 1700123K08Rik

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_083969.1 Gene:1700123K08Rik / 76658 MGIID:1923908 Length:295 Species:Mus musculus


Alignment Length:163 Identity:29/163 - (17%)
Similarity:63/163 - (38%) Gaps:43/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 YLKKVRYHRPTPTASNDSDDE---------ISHLEWETVRVRFVKAATLARLVEALATDDGELES 263
            :|:...:..|.....||.:.:         ....|:....:.::.||...|            :.
Mouse    34 HLRHASHSEPKVCCENDQEPDSMPKHPQFNYKSREYVQQMIHYIPAAIQNR------------DH 86

  Fly   264 TFINVFLSTYRTFSTPKQVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQHKKT 328
            ..:::|::.|:|::|..:||.||.:.|.:.....:|:                      :|.|:.
Mouse    87 LCLDIFVAMYQTYATTWEVLDLLMKTYASFQPDFVED----------------------QQTKRA 129

  Fly   329 LVSALHVWLDGFPEDWHEDNLQQILAFATKRLK 361
            :.|.|..|...||:|::|.....:|:..|:.::
Mouse   130 IFSFLFGWFQKFPQDFYESPDLAVLSQFTEYVR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 22/116 (19%)
RasGEF 454..719 CDD:214539
RalGDS_RA 858..946 CDD:176351
1700123K08RikNP_083969.1 REM 89..176 CDD:100121 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.