Sequence 1: | NP_001261814.1 | Gene: | Rgl / 44115 | FlyBaseID: | FBgn0026376 | Length: | 973 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081345.2 | Gene: | 1700018F24Rik / 69396 | MGIID: | 1916646 | Length: | 314 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 38/197 - (19%) |
---|---|---|---|
Similarity: | 70/197 - (35%) | Gaps: | 55/197 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 KPTWRLW--GEEHEKNAIFTVYLKKVRYHRPTPTASNDSDDEISHLEWETVRVRFVKAATLARLV 251
Fly 252 EALATDDGELESTFINVFLSTYRTFSTPKQVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYD 316
Fly 317 PHASIHEQHKKTLVSALHVWLDGFPEDWHED-NL---QQILAFATKRLKRSDLHIKVLNRLERLI 377
Fly 378 KQ 379 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rgl | NP_001261814.1 | REM | 246..378 | CDD:100121 | 27/135 (20%) |
RasGEF | 454..719 | CDD:214539 | |||
RalGDS_RA | 858..946 | CDD:176351 | |||
1700018F24Rik | NP_081345.2 | REM | 63..176 | CDD:100121 | 29/146 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3629 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |