DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and 1700018F24Rik

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_081345.2 Gene:1700018F24Rik / 69396 MGIID:1916646 Length:314 Species:Mus musculus


Alignment Length:197 Identity:38/197 - (19%)
Similarity:70/197 - (35%) Gaps:55/197 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 KPTWRLW--GEEHEKNAIFTVYLKKVRYHRPTPTASNDSDDEISHLEWETVRVRFVKAATLARLV 251
            :|....|  .:.:.|...|...|.|..|               :..|:....:.::.||....  
Mouse    30 RPLTHFWHASDRNPKEPDFPYNLPKFTY---------------NSFEFVEQMIAYIPAAVHYH-- 77

  Fly   252 EALATDDGELESTFINVFLSTYRTFSTPKQVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYD 316
                      :...|::||:.|..:.:..:||.||.:.|                      |::.
Mouse    78 ----------DQLSISLFLAVYHRYCSTWEVLDLLMKTY----------------------PSFQ 110

  Fly   317 PHASIHEQHKKTLVSALHVWLDGFPEDWHED-NL---QQILAFATKRLKRSDLHIKVLNRLERLI 377
            |.....:..|..:.|.|..|||.|||.:.:. ||   :|::.:|.:.:..::...:....|.||.
Mouse   111 PDCKQDQLTKSAIFSFLAHWLDTFPEHFFDSPNLAVMRQLMDYAGRHMPSAEFDKESRELLSRLE 175

  Fly   378 KQ 379
            :|
Mouse   176 EQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 27/135 (20%)
RasGEF 454..719 CDD:214539
RalGDS_RA 858..946 CDD:176351
1700018F24RikNP_081345.2 REM 63..176 CDD:100121 29/146 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.