DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and RGD1559804

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001381727.1 Gene:RGD1559804 / 498591 RGDID:1559804 Length:211 Species:Rattus norvegicus


Alignment Length:240 Identity:54/240 - (22%)
Similarity:84/240 - (35%) Gaps:68/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ACTGATLR--NLSKKTKDLHAKNYTYTKPTW---------RLWGEEHEKNAIFTVYLKKVR---- 213
            :|...|.|  .|.|..::.|.       ..|         |||           .:.:|||    
  Rat     3 SCCLRTTRGSGLKKDNREGHG-------GVWRHRVRSCLRRLW-----------PFSRKVRSSTK 49

  Fly   214 ---YHRPTPTASNDS-DDEISHLEWETVRVRFVKAATLARLVEALATDDGELESTFINVFLSTYR 274
               .|..|..:.||| ..::|    |:.|...:....:.:|...|.....|.::.::..|...|:
  Rat    50 TSQSHEHTDKSENDSAAQDLS----ESYRDSSISTEAVVKLGNKLGPSLQEGDTFYVPAFSIIYQ 110

  Fly   275 TFSTPKQVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQHKKTLVSALHVWLDG 339
            .|.||..||..|..||                      ..:.|:....||....|.|.|..|:|.
  Rat   111 RFDTPLLVLDQLFLRY----------------------ANFSPYCEEDEQINNALCSFLETWMDK 153

  Fly   340 FPEDWHEDN----LQQILAFATKRLKRSDLHIKVLNRLERLIKQS 380
            ..||:.|.:    |:.|.|:....:...||.::| ||...|::.:
  Rat   154 NTEDYCEPSELFILKYIKAYFDVCMAHLDLSVQV-NRFMTLLQDN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 33/135 (24%)
RasGEF 454..719 CDD:214539
RalGDS_RA 858..946 CDD:176351
RGD1559804NP_001381727.1 REM 83..171 CDD:413353 25/109 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.