DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and CG5522

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster


Alignment Length:440 Identity:117/440 - (26%)
Similarity:176/440 - (40%) Gaps:97/440 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 HGPIYRGPTHFLQAFRFPHVPVRHFAEQLTRMDTELFKRLIPHQCLGHTWARRDSG-GSETVVAT 499
            |..|.:.....|.|.|   ||....|.|:|.:|..:|.::.|.:.....|.::|.. .:..:||.
  Fly   149 HASIKQLDAVILSALR---VPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAF 210

  Fly   500 INQFNAVLFRVVSSILIDRLKPQERALNISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSK 564
            ..:||...|..|..|| :..:|::||..|:.:|.:|::|..|.|..||.|||||:.|.|||||:|
  Fly   211 TKRFNHTSFWTVQEIL-NAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTK 274

  Fly   565 IWEVLPKERMEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTS 629
            .|..|.|:....|..|::|.|:.:|...||.                    :|:.|.|       
  Fly   275 TWACLSKKDRNAFDRLSDIFSDQDNWANLRS--------------------YLESLRL------- 312

  Fly   630 HGTIPYLGTFLTDLTMIHTANPDYLTENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFD 694
             ..|||||.|||||..|..|:|.   :..|....::.|...:|..|...| .:|..:||......
  Fly   313 -PCIPYLGLFLTDLIYIDLAHPH---KGGLEPEQRRNKMNNILRVISNYQ-QSNYKHLQKHEATQ 372

  Fly   695 HWFNSMPVFD------EREAFELSCRLEPPPPA-PRKSVVST----------------NTSLTNT 736
            .:..|:...:      |.:.::.|..|||..|: |..|..|:                |.|...|
  Fly   373 KYLTSIRYIEELQNIFEEDQYKRSLNLEPASPSGPSSSSCSSKESFNVEVVTPALGCLNLSPAKT 437

  Fly   737 -----TASSTASIMGHRKTDSIHSNSSSGAGSQFYCE------------LNSSTSSR-------- 776
                 .||.|..:.||||..|:.:...|.:..:.:.|            :.:.::.|        
  Fly   438 IGSMRMASGTKFVPGHRKCRSLGTKFRSSSLPRNFAEKCQCCIVMIAPGIGTISNKRCRCRRIFG 502

  Fly   777 ----HNSLDRDVHHQHASLMSASSSVSNLSLDSSNSGGRQSGKLTHSQSM 822
                ||..|...||.|..|..:.....:..||.|        .|.||.::
  Fly   503 KIATHNHSDGHPHHLHLELDPSQVQPRHHLLDDS--------VLEHSDAL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121
RasGEF 454..719 CDD:214539 81/271 (30%)
RalGDS_RA 858..946 CDD:176351
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 79/272 (29%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.