DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and Rasgef1c

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001101743.1 Gene:Rasgef1c / 360519 RGDID:1311549 Length:466 Species:Rattus norvegicus


Alignment Length:541 Identity:118/541 - (21%)
Similarity:197/541 - (36%) Gaps:154/541 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 AATLARLVEALA-TDDGELESTFINVFLSTYRTFSTPKQVLSLLTQRYDALHEKHLEELEQAQQN 307
            :|:|..|::.|. |.|...|..:|..||.:.|.|..|:::|:.:.         || .:||.|.:
  Rat    40 SASLETLIQHLVPTADYYPEKAYIFTFLLSSRLFIEPRELLARVC---------HL-CIEQQQLD 94

  Fly   308 GQVMDPAYDPHASIHEQHKKTLVSALHVWLDGFPEDWHEDNLQQILAFATKRLKRSDLHIKVLNR 372
            ..|:|     .|.:.:...| |:..|..|.:.||.|:.|::....|.....|:...|        
  Rat    95 KPVLD-----KARVRKFGAK-LLQLLAEWTETFPRDFEEESTIGHLTDVVGRISPCD-------- 145

  Fly   373 LERLIKQSLYGNGGGSGGSENNGHSWLSAARSQQMQQFMIPTHYGSSYDLTDQFNGMYLSPMGHG 437
                   ..|||                     :|.|.:...|             ..|:.:|.|
  Rat   146 -------ETYGN---------------------RMHQLLQTLH-------------QKLASLGQG 169

  Fly   438 P-------------------IYRGPTHFLQAFRFPHVPVRHFAEQLTRMDTELFKRLIPHQCLGH 483
            |                   |:|   ..|.....|:.    .|:|||.::.|..:.:.|.:.: .
  Rat   170 PEGLVGADKPISYRTKPPASIHR---ELLGVCSDPYT----LAQQLTHVELERLRHIGPEEFV-Q 226

  Fly   484 TWARRD---------SGGSETVVATINQFNAVLFRVVSSILIDRLKPQERALNISRWIDIAQELR 539
            .:..:|         :..:..|.|.:..||.:.:.|.:.|.:. .|.::||..|..:||:|:|..
  Rat   227 AFVNKDPLAGTKPRFNDKTNNVEAYVKWFNRLCYLVATEICMP-AKKKQRAQVIEFFIDVARECF 290

  Fly   540 MLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTE----LANICSEDNNAWTLREVLKRE 600
            .:.||:||.||||.:|.:.:.||.|.|..:...:..:...    ..|.|   |....||....|.
  Rat   291 NIGNFNSLMAIISGMNMSPVSRLKKTWAKVKTAKFFILEHQMDPTGNFC---NYRTALRGAAHRS 352

  Fly   601 GTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYLTENKLINFDKK 665
            .||        ||.|  :|::           ||:....:.|:..::....:.| .|..:||:  
  Rat   353 LTA--------HSSR--EKIV-----------IPFFSLLIKDIYFLNEGCANRL-PNGHVNFE-- 393

  Fly   666 RKEFEVLAQIKLLQGAANTYN-----LQADALFDHWFNSMPVFDEREAFELSCRLEPPPPAPRKS 725
             |..|:..|:    |...|:.     .:.|....|:..:.|:|.|...:..|...|.|       
  Rat   394 -KFLELAKQV----GEFITWKQVECPFEQDPSITHYLYTAPIFSEDGLYLASYESESP------- 446

  Fly   726 VVSTNTSLTNTTASSTASIMG 746
               .|.:......|..:||:|
  Rat   447 ---ENQTEKERWKSLRSSILG 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 32/132 (24%)
RasGEF 454..719 CDD:214539 65/282 (23%)
RalGDS_RA 858..946 CDD:176351
Rasgef1cNP_001101743.1 REM 42..163 CDD:100121 38/185 (21%)
RasGEF 200..447 CDD:214539 67/294 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.