DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and RGL4

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001316353.1 Gene:RGL4 / 266747 HGNCID:31911 Length:580 Species:Homo sapiens


Alignment Length:389 Identity:120/389 - (30%)
Similarity:177/389 - (45%) Gaps:67/389 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 PVRHFAEQLTRMDTELFKRLIPHQCLGHTWARRDSGGSE----TVVATINQFNAVLFRVVSSILI 516
            |.|..|||||.||.||||:::.|:|||..|.:....|:|    ||.|||..||.:...:.:|.|.
Human   219 PPRLLAEQLTLMDAELFKKVVLHECLGCIWGQGHLKGNEHMAPTVRATIAHFNRLTNCITTSCLG 283

  Fly   517 DR-LKPQERALNISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTEL 580
            |. ::.::||..:..||.:|:|...|.||||:..|:|||.||.|.:|.|.|..:..:.|:   ||
Human   284 DHSMRARDRARVVEHWIKVARECLSLNNFSSVHVIVSALCSNPIGQLHKTWAGVSSKSMK---EL 345

  Fly   581 ANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTM 645
            ..:|.:|..  ..|::|.:.|:.|...     .:|:.|::.:.|..| ..|.:|:||.|||:|..
Human   346 KELCKKDTA--VKRDLLIKAGSFKVAT-----QERNPQRVQMRLRRQ-KKGVVPFLGDFLTELQR 402

  Fly   646 IHTANPDYLTENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFDHWFNSMPVFDERE--A 708
            :.:|.||.|..|.    :|:.||..||.:::|||.||..|.|:....|..:|..|....::|  .
Human   403 LDSAIPDDLDGNT----NKRSKEVRVLQEMQLLQVAAMNYRLRPLEKFVTYFTRMEQLSDKERWG 463

  Fly   709 FELSCR---------LEPPPPAPRKSVVSTNTSLTNTTASSTASIMGHRKT-----DSIHSNSSS 759
            |.:..|         :.||.| |:...:.....|.          .|.||.     .::..|...
Human   464 FTMMSRIVSNSWPQAIHPPQP-PKVLTLQLQAVLP----------AGARKPVGWQHPAVAGNPPG 517

  Fly   760 GAGSQFYCEL------NSSTSSR------HNSLDRDVHHQHASLMSASSSVSNLSLDSSNSGGR 811
            .......|.:      :..|:||      |.:|  |.|||...|....      ..|...||||
Human   518 CWPEHRLCTIPHPDRRHQGTTSRRLAAQLHLAL--DPHHQLLLLARIR------PWDFCESGGR 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121
RasGEF 454..719 CDD:214539 96/278 (35%)
RalGDS_RA 858..946 CDD:176351
RGL4NP_001316353.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116220at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.