DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and RASGEF1A

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001269791.1 Gene:RASGEF1A / 221002 HGNCID:24246 Length:489 Species:Homo sapiens


Alignment Length:521 Identity:113/521 - (21%)
Similarity:197/521 - (37%) Gaps:117/521 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 AATLARLVEALA-TDDGELESTFINVFLSTYRTFSTPKQVLSLLTQRYDALHEKHLEELEQAQQN 307
            :.:|..|:|.|. |.|...:.|:|..||.:.|.|..|..:|:    |...:..:..::||...:.
Human    55 SGSLEALMEHLVPTVDYYPDRTYIFTFLLSSRVFMPPHDLLA----RVGQICVEQKQQLEAGPEK 115

  Fly   308 GQVMDPAYDPHASIHEQHKKTLVSALHVWLDGFPEDWHEDNLQQILAFATKRLKRSDLHIKVLNR 372
            .::            :.....:|..|..|.:.||.|:.::.....|...|.|:.:.|.....:.:
Human   116 AKL------------KSFSAKIVQLLKEWTEAFPYDFQDEKAMAELKAITHRVTQCDEENGTVKK 168

  Fly   373 LERLIKQSLYGNGGGSGGSENNGHSWLSAARSQQMQQFMIPTHYGSSYDLTDQFNGMYLSP--MG 435
            ....:.|||.                ||.|...|:|            :|.::     |.|  :.
Human   169 AIAQMTQSLL----------------LSLAARSQLQ------------ELREK-----LRPPAVD 200

  Fly   436 HGPIYR-----GPTHFLQAFRFPHVPVRHFAEQLTRMDTELFKRLIP---------------HQC 480
            .|||.:     .....|.....|.|    .|:|||.::.:....:.|               |:|
Human   201 KGPILKTKPPAAQKDILGVCCDPLV----LAQQLTHIELDRVSSIYPEDLMQIVSHMDSLDNHRC 261

  Fly   481 LGHTWARRDSGGSETVVATINQFNAVLFRVVSSILIDRLKPQERALNISRWIDIAQELRMLKNFS 545
            .|      |...:.::.|..|.||. |..:|::.:...:|.:.|...:..:||:|:|...:.||:
Human   262 RG------DLTKTYSLEAYDNWFNC-LSMLVATEVCRVVKKKHRTRMLEFFIDVARECFNIGNFN 319

  Fly   546 SLKAIISALNSNSIYRLSKIWEVLPKERMEVFTE----LANICSEDNNAWTLREVLKREGTAKNP 606
            |:.||||.:|.:.:.||.|.|..:...:.:|...    .:|.|   |....|:...:|...|   
Human   320 SMMAIISGMNLSPVARLKKTWSKVKTAKFDVLEHHMDPSSNFC---NYRTALQGATQRSQMA--- 378

  Fly   607 DPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYLTENKLINFDKKRKEFEV 671
                 :|.|  :|::           ||....|:.|:..:|..:.::| .|..|||   :|.:|:
Human   379 -----NSSR--EKIV-----------IPVFNLFVKDIYFLHKIHTNHL-PNGHINF---KKFWEI 421

  Fly   672 LAQI-KLLQGAANTYNLQADALFDHWFNSMPVFDEREAFELSCRLEPPPPAPRKSVVST-NTSLT 734
            ..|| :.:.........:.|.....:..:.|::.|...|..|...|.|.....|....| .|:|.
Human   422 SRQIHEFMTWTQVECPFEKDKKIQSYLLTAPIYSEEALFVASFESEGPENHMEKDSWKTLRTTLL 486

  Fly   735 N 735
            |
Human   487 N 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 27/132 (20%)
RasGEF 454..719 CDD:214539 64/284 (23%)
RalGDS_RA 858..946 CDD:176351
RASGEF1ANP_001269791.1 REM 57..184 CDD:100121 33/158 (21%)
RasGEF 222..470 CDD:214539 65/286 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.