DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and Rasgrp2

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_035372.2 Gene:Rasgrp2 / 19395 MGIID:1333849 Length:608 Species:Mus musculus


Alignment Length:608 Identity:126/608 - (20%)
Similarity:212/608 - (34%) Gaps:190/608 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 LEEL-----EQAQQNGQVMDPA-----------YDPHASI-------HEQHKKTLVSALHV---- 335
            :|||     |....:|:|.||.           |.|.:.:       ::|.:|...::|.:    
Mouse    13 VEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFYQQSRKDNSNSLQMKTCH 77

  Fly   336 ----WLDGFPEDWHEDNLQQILAFATKRLKRSDLHIKVLNRLERLIKQSLYGNGGGSGGSENNGH 396
                |:..||.::   :|...||...|.||             .|:.|           ..|..|
Mouse    78 LVRYWISAFPAEF---DLNPELAEQIKELK-------------ALLDQ-----------EGNRRH 115

  Fly   397 SWLSAARSQQMQQFMIPTHYGSSYDLTDQFNGMYLSPMGHGPIYRGPTHFLQAFRFPHVPVRHFA 461
            |.|....|       :|| |.....:|.:           .|:.:....  .:..|.|:.....|
Mouse   116 SSLIDIES-------VPT-YKWKRQVTQR-----------NPVEQKKRK--MSLLFDHLEPMELA 159

  Fly   462 EQLTRMDTELFKRL--------IPHQCLGHTWARRDSGGSETVVATINQFNAVLFRVVSSILIDR 518
            |.||.::...|.::        :.|.|         :..:..:...|:.||:| .:.|..:::.:
Mouse   160 EHLTYLEYRSFCKILFQDYHSFVTHGC---------TVDNPVLERFISLFNSV-SQWVQLMILSK 214

  Fly   519 LKPQERALNISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLS-----------KIWEVLPKE 572
            ....:|||.|:.::.:|:.|..|:||::|.|::..|:.:||.||.           |:||.|   
Mouse   215 PTATQRALVITHFVHVAERLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGL--- 276

  Fly   573 RMEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLG 637
                 |||.......:|                          :.::|...:|.:     .|.||
Mouse   277 -----TELVTATGNYSN--------------------------YRRRLAACVGFR-----FPILG 305

  Fly   638 TFLTDLTMIHTANPDYLTENKL-INFDKKRKEFEVLAQIKLLQGAANTYNLQADAL------FDH 695
            ..|.||..:..|.||:|...:. :|..|.|:.|.:|.::.::...........|.|      .|.
Mouse   306 VHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSLRPPVQANPDLLSLLTVSLDQ 370

  Fly   696 WFNSMPVFDEREAFELSCRLEP-------------PPPAPRKSVVSTNTSLTNTTASSTASIMGH 747
            :..      |.|.::||.:.||             |||.|  .|:...||:....... |.:..|
Mouse   371 YQT------EDELYQLSLQREPRSKSSPTSPTSCTPPPRP--PVLEEWTSVAKPKLDQ-ALVAEH 426

  Fly   748 --RKTDSIHSN---SSSGAGSQFYCEL---NSSTSSRHNSLDRDVHHQHASLMSASSSVSNLSLD 804
              :..:|:..|   ...|..||...::   |....|....||::    ....:|....:|.....
Mouse   427 IEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQN----QDGCISREEMISYFLRS 487

  Fly   805 SSNSGGRQSGKLTHSQSMGNGLK 827
            ||..|||..  ..|:....|.|:
Mouse   488 SSVLGGRMG--FVHNFQESNSLR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 23/110 (21%)
RasGEF 454..719 CDD:214539 63/303 (21%)
RalGDS_RA 858..946 CDD:176351
Rasgrp2NP_035372.2 RasGEFN 7..121 CDD:214571 28/134 (21%)
RasGEF 150..387 CDD:214539 63/291 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..405 6/24 (25%)
EFh 430..481 CDD:238008 10/54 (19%)
C1 499..548 CDD:237996 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.