DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and LOC110438234

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_021324867.1 Gene:LOC110438234 / 110438234 -ID:- Length:264 Species:Danio rerio


Alignment Length:182 Identity:60/182 - (32%)
Similarity:91/182 - (50%) Gaps:22/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GEEHEKNAIFTVYLKKVRYHRPTPTASNDSDDEISHLEWETVRVRFVKAATLARLVEALATDDGE 260
            |||.|:.|:|::.::||:.::     |:.|..:..|.:..|.::|.:||.||.||||.:.|....
Zfish    16 GEEVEEGAVFSITVRKVQVYQ-----SSSSRGQQQHSDSHTCKLRSIKAGTLERLVENMLTAFRG 75

  Fly   261 LESTFINVFLSTYRTFSTPKQVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQH 325
            .:||::.:||.|||||:|.||||.||..||..|         |.|....|.....|....:    
Zfish    76 NDSTYVTIFLCTYRTFATTKQVLDLLLNRYAKL---------QQQPGPDVRRMTSDERTEL---- 127

  Fly   326 KKTLVSALHVWLDGFPED-WHEDN---LQQILAFATKRLKRSDLHIKVLNRL 373
            :.|:.|.|..|||.:.|| |....   |::::.:.......|||..:..|.|
Zfish   128 RNTISSILGAWLDQYSEDFWKPPEYSCLRRLILYLQINFPGSDLERRACNLL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 45/132 (34%)
RasGEF 454..719 CDD:214539
RalGDS_RA 858..946 CDD:176351
LOC110438234XP_021324867.1 RasGEFN 53..179 CDD:214571 47/138 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116220at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.