DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and LOC102552619

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_017453122.1 Gene:LOC102552619 / 102552619 RGDID:7567332 Length:206 Species:Rattus norvegicus


Alignment Length:114 Identity:33/114 - (28%)
Similarity:47/114 - (41%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 LSTYRTFSTPKQVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQHKKTLVSALH 334
            ||.||..:||.|:|.||..|:..|                      .|::...||.|.||.|.|.
  Rat    90 LSAYRRIATPLQILDLLFVRHSYL----------------------SPYSKEDEQVKNTLWSFLE 132

  Fly   335 VWLDGFPEDWHED-------NLQQILAFATKRLKRSDLHIKVLNRLERL 376
            .|:|..|  |.:.       .||.:.|:.:..:..|||.::|...|.:|
  Rat   133 TWMDKNP--WMDFCDPSDMLPLQYLEAYLSVYIPNSDLIVRVKILLTQL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 33/114 (29%)
RasGEF 454..719 CDD:214539
RalGDS_RA 858..946 CDD:176351
LOC102552619XP_017453122.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.