DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and rapgef4

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_031749210.1 Gene:rapgef4 / 100497690 XenbaseID:XB-GENE-6048644 Length:1033 Species:Xenopus tropicalis


Alignment Length:306 Identity:77/306 - (25%)
Similarity:133/306 - (43%) Gaps:55/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 DQFNGMYLSPMGHGPIYRGPTHFLQAFRFPHVPVRHFAEQLTRMDTELFKRLIPHQCLGHTWARR 488
            |||:.  |:|:   |...||:....: .|..:..:..|.|:|..|.:||..:...:.:.||:.|:
 Frog   768 DQFDS--LTPL---PEQEGPSAGTMS-TFELMSSKDLAYQMTIHDWDLFSCVHELELIYHTFGRQ 826

  Fly   489 D-SGGSETVVATINQFNAVLFRVVSSILIDRLKPQ--ERALNISRWIDIAQELRMLKNFSSLKAI 550
            : ...:..:...:.:||.:.|.||:.|.   |.||  :|...:.::|.||...:..||.:|..||
 Frog   827 NFKKTTANLDLFLRRFNEIQFWVVTEIC---LCPQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAI 888

  Fly   551 ISALNSNSIYRLSKIWEVLPKERMEVFTELANIC--SEDNNAWTLREVLKREGTAKNPDPGSDHS 613
            :..|::.::.|||..||.||.:..:::.|..|:.  |.::.|:.|        |....||     
 Frog   889 VMGLSNVAVSRLSLTWEKLPSKFKKIYAEFENLMDPSRNHRAYRL--------TVAKLDP----- 940

  Fly   614 DRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYLTENKLINFDKKRKEFEVLAQIKLL 678
                             ..||:....:.|:|..|..|..::  :.|:||:|.|.....|..|:..
 Frog   941 -----------------PIIPFTPLLIKDMTFTHEGNKTFI--DNLVNFEKMRMIANTLRTIRYC 986

  Fly   679 QGAANTYNLQAD-ALFDH-----WFNSMPVFD-EREAFELSCRLEP 717
            :..  .:|..|. |..:|     :.....|.| :|...::|.||||
 Frog   987 RSV--PFNPDASLAGKNHQDVRNYVRQFNVIDNQRTLSQMSHRLEP 1030

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121
RasGEF 454..719 CDD:214539 68/276 (25%)
RalGDS_RA 858..946 CDD:176351
rapgef4XP_031749210.1 CAP_ED 43..158 CDD:237999
DEP_Epac 228..356 CDD:239884
CAP_ED 378..489 CDD:237999
RasGEF_N 521..627 CDD:395493
RasGEF 790..1031 CDD:214539 69/278 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.