DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and zbtb22

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_002938727.2 Gene:zbtb22 / 100488727 XenbaseID:XB-GENE-6458515 Length:436 Species:Xenopus tropicalis


Alignment Length:166 Identity:36/166 - (21%)
Similarity:55/166 - (33%) Gaps:47/166 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 LEELEQAQQNGQVMDPAYDPHASIHEQHKKTLVSA---LH--VWLDG-----FPEDWHEDNLQQI 352
            ||.|.|.:..|::.|.:......:...|:..|.::   .|  |.|.|     .|........:.:
 Frog    20 LESLNQQRMEGKLCDVSIHAQGRVFRAHRAVLAASSPYFHDQVLLKGMSSVSLPGVVDPGAFEAV 84

  Fly   353 LAFA-TKRLKR------------SDLHI-KVLNRLERLIKQSLYGNGGG--SGGSENNGHSWLSA 401
            |..| |.||..            |.|.: .|:::...|:|:|..||..|  .|.....|      
 Frog    85 LCAAYTGRLTMLADEIVNYLTVGSVLQMWHVVDKCSELLKESRGGNSCGIVEGAGSTTG------ 143

  Fly   402 ARSQQMQQFMIPT----HYGSSYDLTDQFNGMYLSP 433
                       ||    |.|.:.:.....:..|.||
 Frog   144 -----------PTPQRPHSGRASENQSPSSSNYFSP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121 22/103 (21%)
RasGEF 454..719 CDD:214539
RalGDS_RA 858..946 CDD:176351
zbtb22XP_002938727.2 BTB_POZ_ZBTB22_BING1 12..123 CDD:349519 21/102 (21%)
C2H2 Zn finger 339..358 CDD:275368
zf-H2C2_2 352..374 CDD:372612
zf-C2H2 364..386 CDD:333835
C2H2 Zn finger 366..386 CDD:275368
zf-H2C2_2 378..401 CDD:372612
C2H2 Zn finger 394..418 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3248
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48328
Panther 1 1.100 - - O PTHR23113
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3106
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.