DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and rgl3b

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_002667459.1 Gene:rgl3b / 100329330 ZFINID:ZDB-GENE-101130-2 Length:230 Species:Danio rerio


Alignment Length:225 Identity:72/225 - (32%)
Similarity:111/225 - (49%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   733 LTNTTASSTASIMGHRKTDSIHSNSSSGAGSQFYCELNSSTSS----RHNSLDR-------DVHH 786
            ||...:|..:...|.||.....|.||||:.|....:::|.:|:    .|:|..:       ..:.
Zfish     2 LTKKLSSLLSGNEGSRKNADQISVSSSGSSSSETEDMSSQSSAFISPSHSSCGQSSTEAFPSSYT 66

  Fly   787 QHASLMSASSSVSNLSLDSSNSGGRQSGKLTHSQSMGNGLKSHGNGTTNGGSPHINAQLVQPSSG 851
            ..:|:||:||..|...|..|......|...:..|.:.:..:|....|.    |..|.|:      
Zfish    67 PDSSIMSSSSFSSQQDLSLSQPSPSSSSASSDPQHVSSHKRSFSMTTL----PFYNRQV------ 121

  Fly   852 TPHSAPDFYIIRVTYETDNIELDGIVLYKSIMLGNNERTPQVIRNAMLKLGLED-DPDRFTLAQV 915
                 .|..||||:.|..|   :| .:||||:|.:.::|.|||:.|:.|..||| |...|||.|:
Zfish   122 -----DDSCIIRVSVEFCN---NG-NMYKSILLTSQDKTAQVIQRALQKHNLEDVDEQDFTLIQI 177

  Fly   916 LPD-KELVMPKNANVYYAVNTNYNLNFILR 944
            |.. :||::|:.|||:||::|:.|.:|:||
Zfish   178 LAQGRELLIPEKANVFYAMSTSANYDFVLR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121
RasGEF 454..719 CDD:214539
RalGDS_RA 858..946 CDD:176351 41/89 (46%)
rgl3bXP_002667459.1 RalGDS_RA 123..208 CDD:176351 41/89 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116220at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.