DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgl and rasgrp1

DIOPT Version :9

Sequence 1:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001093748.2 Gene:rasgrp1 / 100101791 XenbaseID:XB-GENE-489811 Length:811 Species:Xenopus tropicalis


Alignment Length:377 Identity:94/377 - (24%)
Similarity:152/377 - (40%) Gaps:64/377 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 FPHVPVRHFAEQLTRMDTELFKRL--------IPHQCLGHTWARRDSGGSETVVATINQFNAVLF 508
            |.|:..:..||.||.::.:.|:|:        |...|:      :::...|..:|..|..:    
 Frog   217 FDHLEPQELAEHLTYLEFKAFRRISFSDYQNYIVSGCV------KENPTMERSIALCNGIS---- 271

  Fly   509 RVVSSILIDRLKPQERALNISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKER 573
            :.|..:::.|..||.||..::::|.:||:|..|:||::|.|:|..|..:||.||......:..:.
 Frog   272 QWVQLMVLSRPTPQLRAEVLTKFIHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKDTSAHVSHDV 336

  Fly   574 MEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGT 638
            .:|..|:..:.|...|....|.|.                            .:.::..||.||.
 Frog   337 NKVLNEMTELLSSCRNYDNYRRVY----------------------------NECTNFKIPILGV 373

  Fly   639 FLTDLTMIHTANPDYLTENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFDHWFNSMPVF 703
            .|.||..:|.|.||:|.::| ||..|....:..:.::..||..|.......|.:.....:....:
 Frog   374 HLKDLIALHEAMPDFLEDSK-INVPKLHSLYNHINELIQLQNIAPPLEANMDLVHLLTLSLDLYY 437

  Fly   704 DEREAFELSCRLEP-----PPPAPRKSVVSTNTSLTNTTASSTASIMGH--RKTDSIHSN---SS 758
            .|.|.:|||...||     ||..|.|..|..:.:...:......:|..|  |..||:..|   ..
 Frog   438 TEDEMYELSYAREPRNHRAPPVTPSKPPVVADWASGVSPKPDPKTISKHVQRMVDSVFKNYDLDQ 502

  Fly   759 SGAGSQFYCE-LNSSTSSRHNSLDRD----VHHQH--ASLMSASSSVSNLSL 803
            .|..||...| :.:|.......:|:|    :..|.  |..|.|||..|.|.|
 Frog   503 DGYISQEEFEKIAASFPFSFCVMDKDREGLISRQEITAYFMRASSICSKLGL 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RglNP_001261814.1 REM 246..378 CDD:100121
RasGEF 454..719 CDD:214539 66/277 (24%)
RalGDS_RA 858..946 CDD:176351
rasgrp1NP_001093748.2 REM 77..193 CDD:100121
RasGEF 217..453 CDD:214539 67/274 (24%)
EF-hand_7 494..543 CDD:372618 10/48 (21%)
C1_1 558..607 CDD:365894
BRLZ 744..799 CDD:197664
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.