DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and GRAP2

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_004801.1 Gene:GRAP2 / 9402 HGNCID:4563 Length:330 Species:Homo sapiens


Alignment Length:119 Identity:38/119 - (31%)
Similarity:55/119 - (46%) Gaps:29/119 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QQLQQQQQQQQLEQLHHPQI---PEIPIPD--------------------LEQVETQVGDGSLWT 49
            |||||..||:.|:..|..|.   ..:.|.|                    .:.|:.|......|.
Human   212 QQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWA 276

  Fly    50 -ALYDYDAQGEDELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFV 102
             ||||::|..:|||....||:|.||.     |.:..||||::.:|:|:||.::|
Human   277 RALYDFEALEDDELGFHSGEVVEVLD-----SSNPSWWTGRLHNKLGLFPANYV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 24/57 (42%)
STKc_MLK 134..389 CDD:270963
GRAP2NP_004801.1 SH3_GRAP2_N 2..53 CDD:212880
SH2_Grb2_like 54..147 CDD:199828
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..244 12/31 (39%)
SH3_GRAP2_C 275..327 CDD:212883 24/56 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.