DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and RIPK2

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_003812.1 Gene:RIPK2 / 8767 HGNCID:10020 Length:540 Species:Homo sapiens


Alignment Length:343 Identity:101/343 - (29%)
Similarity:170/343 - (49%) Gaps:49/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VSSAIGDIQPHEIEYNELDIKEVI-GSGGFCKVHRGYYDGEEVAIKIAH-QTGEDDMQRMRDNVL 174
            :.||:..|..|::    .|::.:. |:.|.....|......:||:|..| .|...|.:  |.:||
Human     6 ICSALPTIPYHKL----ADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSE--RKDVL 64

  Fly   175 QEAKLFWALKHENIAALRGVCLNTK-LCLVMEYARGGSLNRILAGKIP-PDVLVNWAI------Q 231
            :||::....:...|..:.|:|...: |.:|.||...||||.:|..|.. |||.  |.:      :
Human    65 REAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVA--WPLRFRILHE 127

  Fly   232 IARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLA--REMYNTQRMSA-- 292
            ||.|:|||||..| .::|.|||:.|:|:.....        :||.||||:  |.|..:|..|:  
Human   128 IALGVNYLHNMTP-PLLHHDLKTQNILLDNEFH--------VKIADFGLSKWRMMSLSQSRSSKS 183

  Fly   293 ---AGTYAWMPPEVISVSTYSKFS---DVWSYGVLLWELITGETPYKGF-DPLSVAYGVA----- 345
               .||..:||||.......|:.|   |::||.|:.||:::.:.|::.. :||.:.|.|:     
Human   184 APEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRP 248

  Fly   346 -VNTLTLP--IPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSKFTLTPQESFHYMQE 407
             :|..:||  ||......  :|::|.|..:|.:||.|.:.|.:||.:..:...:|..|:...:::
Human   249 VINEESLPYDIPHRARMI--SLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKK 311

  Fly   408 CWRKEIAGVLHDLREKEK 425
            ...:.::..:| |.:|:|
Human   312 TKLQSVSSAIH-LCDKKK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 89/285 (31%)
STKc_MLK 134..389 CDD:270963 90/283 (32%)
RIPK2NP_003812.1 STKc_RIP2 20..303 CDD:270928 92/297 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..369
CARD_RIP2_CARD3 438..524 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.