DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT1G73660

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_177507.1 Gene:AT1G73660 / 843701 AraportID:AT1G73660 Length:1030 Species:Arabidopsis thaliana


Alignment Length:321 Identity:110/321 - (34%)
Similarity:160/321 - (49%) Gaps:35/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SGDVGWWTGKIGDKVGVFPKDFVTDEDPLQLNVSSAIGDIQPHEIEYNELDIKEVIGSGGFCKVH 144
            |||........|::        ::|:.....:..|...|:...||.:.|:.:.|.||.|.:.:|:
plant   707 SGDSNHGPNSGGER--------ISDKSIGNESSKSDCDDVSDCEILWEEITVGERIGLGSYGEVY 763

  Fly   145 RGYYDGEEVAI-KIAHQ--TGEDDMQRMRDNVLQEAKLFWALKHENIAALRG-VCLNTKLCLVME 205
            ||.:.|.|||: |...|  ||| .::..|    .|.::...|:|.||....| |.....|.:|.|
plant   764 RGDWHGTEVAVKKFLDQDLTGE-ALEEFR----SEVRIMKKLRHPNIVLFMGAVTRPPNLSIVTE 823

  Fly   206 YARGGSLNRILAGKIPPDVL-----VNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEG 265
            :...|||.|::  ..|.:.|     :..|:..||||||||:..|| |:||||||.|:|    ::.
plant   824 FLPRGSLYRLI--HRPNNQLDERRRLRMALDAARGMNYLHSCNPM-IVHRDLKSPNLL----VDK 881

  Fly   266 NHLQQKTLKITDFGLAREMYNT--QRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITG 328
            |.:    :|:.||||:|..::|  ...|.|||..||.|||:......:..||:||||:||||.|.
plant   882 NWV----VKVCDFGLSRMKHSTYLSSKSTAGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTL 942

  Fly   329 ETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESI 389
            :.|:...:|:.|...|......|.||.........|:..|||||...||.|.||:..|:.:
plant   943 QQPWGKMNPMQVVGAVGFQHRRLDIPDFVDPAIADLISKCWQTDSKLRPSFAEIMASLKRL 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 4/23 (17%)
TyrKc 129..386 CDD:197581 99/267 (37%)
STKc_MLK 134..389 CDD:270963 99/265 (37%)
AT1G73660NP_177507.1 EDR1 179..383 CDD:316869
STKc_MAP3K-like 754..1000 CDD:270901 98/261 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.