DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT1G67890

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_564913.1 Gene:AT1G67890 / 843117 AraportID:AT1G67890 Length:765 Species:Arabidopsis thaliana


Alignment Length:286 Identity:104/286 - (36%)
Similarity:158/286 - (55%) Gaps:21/286 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DIQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWA 182
            |...:||.:.:|.|.|.||.|....|:.|.:.|.:||:|:..:  ::..:.:..:..||..|...
plant   476 DCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSK--QEYSEEIITSFKQEVSLMKR 538

  Fly   183 LKHENIAALRG-VCLNTKLCLVMEYARGGSLNRIL---AGKIPPDVLVNWAIQIARGMNYLHNEA 243
            |:|.|:....| |....:||:|.|:...|||.|:|   ..|:.....::.|..|||||||||:.:
plant   539 LRHPNVLLFMGAVASPQRLCIVTEFLPRGSLFRLLQRNKSKLDLRRRIHMASDIARGMNYLHHCS 603

  Fly   244 PMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAR---EMYNTQRMSAAGTYAWMPPEVIS 305
            | .||||||||||:|:.        :..|:|:.||||:|   |.|.|  .:..||..||.|||:.
plant   604 P-PIIHRDLKSSNLLVD--------RNWTVKVADFGLSRIKHETYLT--TNGRGTPQWMAPEVLR 657

  Fly   306 VSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQ 370
            .....:.|||:|:||:||||:|.:.|::..:.:.|...|......|.:||.....|.|||:|||.
plant   658 NEAADEKSDVYSFGVVLWELVTEKIPWENLNAMQVIGAVGFMNQRLEVPKDVDPQWIALMESCWH 722

  Fly   371 TDPHKRPGFKEILKQLESIACSKFTL 396
            ::|..||.|:|::.:|..:. .|:|:
plant   723 SEPQCRPSFQELMDKLRELQ-RKYTI 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 98/263 (37%)
STKc_MLK 134..389 CDD:270963 96/261 (37%)
AT1G67890NP_564913.1 PAS 101..211 CDD:395786
STKc_MAP3K-like 493..738 CDD:270901 95/257 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.