DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and NP2

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001319236.1 Gene:NP2 / 841937 AraportID:AT1G54960 Length:651 Species:Arabidopsis thaliana


Alignment Length:266 Identity:78/266 - (29%)
Similarity:132/266 - (49%) Gaps:25/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EVIGSGGFCKVHRGYY--DGEEVAIK----IAHQTGEDDMQRMRDNVLQEAKLFWALKHENIAAL 191
            ::||.|.|..|:.|..  .||.:|:|    .::...::..|.....:.:|.||...|.|.||...
plant    72 QLIGRGAFGTVYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNLSHPNIVRY 136

  Fly   192 RG-VCLNTKLCLVMEYARGGSLNRILA--GKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLK 253
            .| |..:..|.:::|:..|||::.:|.  |..|..|:..:..|:..|:.||||.|   |:|||:|
plant   137 LGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHA---IMHRDIK 198

  Fly   254 SSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAA----GTYAWMPPEVISVSTYSKFSD 314
            .:|:|:.        .|..:|:.|||.::::.....:|.|    ||..||.||||..:.:|..:|
plant   199 GANILVD--------NQGCIKLADFGASKQVAELATISGAKSMKGTPYWMAPEVILQTGHSFSAD 255

  Fly   315 VWSYGVLLWELITGETPY-KGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPG 378
            :||.|..:.|::||:.|: :.:..::..:.:.......|||..........:..|.|.:|:.||.
plant   256 IWSVGCTVIEMVTGKAPWSQQYKEIAAIFHIGTTKSHPPIPDNISSDANDFLLKCLQQEPNLRPT 320

  Fly   379 FKEILK 384
            ..|:||
plant   321 ASELLK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 78/266 (29%)
STKc_MLK 134..389 CDD:270963 78/265 (29%)
NP2NP_001319236.1 STKc_MAPKKK 67..330 CDD:270783 78/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.