DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT1G18160

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_173254.2 Gene:AT1G18160 / 838395 AraportID:AT1G18160 Length:992 Species:Arabidopsis thaliana


Alignment Length:362 Identity:118/362 - (32%)
Similarity:172/362 - (47%) Gaps:66/362 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LTLRRGEIVVVLST----------DSEVSGDVGWWTG----------KIGDK-VGVFPKDFVTDE 105
            |.|.......|::|          ||..:||.|  :|          :|.|: :|          
plant   640 LELSAAAAAAVMATAAAVSRQFELDSLSNGDAG--SGGLHGVDSGGERISDRSIG---------- 692

  Fly   106 DPLQLNVSS----AIGDIQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIK--IAHQTGED 164
                 |.||    ||.|:...||.:.|:.:.|.||.|.:.:|:||.:.|..||:|  |......:
plant   693 -----NESSKSDAAIDDVAECEILWEEITVAERIGLGSYGEVYRGDWHGTAVAVKKFIDQDITGE 752

  Fly   165 DMQRMRDNVLQEAKLFWALKHENIAALRG-VCLNTKLCLVMEYARGGSLNRIL---AGKIPPDVL 225
            .::..|    .|.::...|:|.||....| |.....|.:|.|:...|||.|::   ..::.....
plant   753 ALEEFR----SEVRMMRRLRHPNIVLFMGAVTRPPNLSIVTEFLPRGSLYRLIHRPNNQLDERKR 813

  Fly   226 VNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNT--Q 288
            :..|:..||||||||:..|: |:||||||.|:|    ::.|.:    :|:.||||:|...:|  .
plant   814 LRMALDAARGMNYLHSCNPV-IVHRDLKSPNLL----VDKNWV----VKVCDFGLSRMKVSTYLS 869

  Fly   289 RMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPI 353
            ..|.|||..||.|||:......:..||:||||:||||.|.:.|:...:|:.|...|......|.|
plant   870 SKSTAGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLDI 934

  Fly   354 PKTCPETWGALMKSCWQTDPHKRPGFKEI---LKQLE 387
            |:........:::.||||||..||.|.||   ||||:
plant   935 PEFVDPGIADIIRKCWQTDPRLRPSFGEIMDSLKQLQ 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 13/62 (21%)
TyrKc 129..386 CDD:197581 94/267 (35%)
STKc_MLK 134..389 CDD:270963 95/265 (36%)
AT1G18160NP_173254.2 EDR1 154..359 CDD:373038
STKc_MAP3K-like 721..967 CDD:270901 91/258 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.