DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and VIK

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_172853.1 Gene:VIK / 837960 AraportID:AT1G14000 Length:438 Species:Arabidopsis thaliana


Alignment Length:367 Identity:118/367 - (32%)
Similarity:173/367 - (47%) Gaps:41/367 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DYDAQGEDELTLRRGEIVVV---LSTDSEVSGDVGWWTGKIGDKVGVFPKDFVTDEDPLQLNVSS 114
            |||.:....:....|.|.||   |...::|:....|....:.|..|...:..:   :.|:.:...
plant    68 DYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMI---ELLKSHGGL 129

  Fly   115 AIGDIQPH----------------EIEYNELDIKE--VIGSGGFCKVHRGYYDGEEVAIKIAHQT 161
            :.|....|                |||..|||...  :||.|.|.::.:.|:.|..||:|....:
plant   130 SYGQNGSHFEPKPVPPPIPKKCDWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPS 194

  Fly   162 GEDDMQRMRDNVLQEAKLFWALKHENIAALRGVCLNTK-LCLVMEYARGGSLNRIL--AGKIPPD 223
            ..||...::| ...|..|...|:|.||....|.....| |.|:.||.|||.|::.|  .|.:.|.
plant   195 LSDDRLVIQD-FRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPT 258

  Fly   224 VLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAR-----E 283
            ..||:|:.|||||.||||| |..|||||||..|||:..: ..:|     ||:.||||::     .
plant   259 TAVNFALDIARGMTYLHNE-PNVIIHRDLKPRNVLLVNS-SADH-----LKVGDFGLSKLIKVQN 316

  Fly   284 MYNTQRMSA-AGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVN 347
            .::..:|:. .|:|.:|.|||.....|.|..||:|:.::|:|::.||.|:...:|...|..|:..
plant   317 SHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDG 381

  Fly   348 TLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESI 389
            .......|.|......|:..||..|.::||.|.:|||:||.|
plant   382 HRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 12/53 (23%)
TyrKc 129..386 CDD:197581 96/267 (36%)
STKc_MLK 134..389 CDD:270963 96/263 (37%)
VIKNP_172853.1 ANK repeat 36..68 CDD:293786 118/367 (32%)
PTZ00322 45..>126 CDD:140343 13/60 (22%)
ANK repeat 70..101 CDD:293786 7/30 (23%)
ANK repeat 103..127 CDD:293786 4/26 (15%)
STKc_MAP3K-like 168..420 CDD:270901 94/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.