DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT5G50000

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_199811.1 Gene:AT5G50000 / 835064 AraportID:AT5G50000 Length:385 Species:Arabidopsis thaliana


Alignment Length:319 Identity:105/319 - (32%)
Similarity:165/319 - (51%) Gaps:44/319 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PLQLNVSSAIGDIQPH---EIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKI------AHQTG 162
            |:.||....:|..:..   ||:.::|.||.|:..|.|..||||.|||::||:|:      .|:: 
plant    57 PVTLNGGGFVGKRKQRLEWEIDPSKLIIKTVLARGTFGTVHRGIYDGQDVAVKLLDWGEEGHRS- 120

  Fly   163 EDDMQRMRDNVLQEAKLFWALKHENIAALRGVCL-----------------NTKLCLVMEYARGG 210
            |.::..:|.:..||..::..|.|.|:....|..:                 |...|:|:||..||
plant   121 EAEIVSLRADFAQEVAVWHKLDHPNVTKFIGATMGASGLQLQTESGPLAMPNNICCVVVEYLPGG 185

  Fly   211 SLNRIL----AGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQK 271
            :|...|    ..|:...::|..|:.:|||::|||::   .|:|||:|:.|:|:.:.        :
plant   186 ALKSYLIKNRRRKLTFKIVVQLALDLARGLSYLHSQ---KIVHRDVKTENMLLDKT--------R 239

  Fly   272 TLKITDFGLAR-EMYNTQRMSA-AGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKG 334
            |:||.|||:|| |..|...|:. .||..:|.|||::.:.|::..||:|:|:.|||:...:.||..
plant   240 TVKIADFGVARVEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPD 304

  Fly   335 FDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSK 393
            .....|...|....|...||:.||....|:||.||..:|.|||...|::..||||..:|
plant   305 LTFSEVTSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 94/285 (33%)
STKc_MLK 134..389 CDD:270963 93/283 (33%)
AT5G50000NP_199811.1 STKc_MAP3K-like 88..356 CDD:270901 90/279 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 170 1.000 Domainoid score I1161
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1119
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.