DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT5G40540

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_198870.1 Gene:AT5G40540 / 834052 AraportID:AT5G40540 Length:353 Species:Arabidopsis thaliana


Alignment Length:320 Identity:100/320 - (31%)
Similarity:152/320 - (47%) Gaps:55/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EYNELDIKEV-----------IGSGGFCKVHRGYYDGEEVAIKIAHQTGE--DDMQRMRDNVLQE 176
            |..|||.|.|           ||.|...|::.|.|..:.|||||. :.||  :::.:......:|
plant    11 EVFELDPKWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIV-KRGESPEEIAKRESRFARE 74

  Fly   177 AKLFWALKHENIAALRGVCLNTKLCLVMEYARGGSLNRILA----GKIPPDVLVNWAIQIARGMN 237
            ..:...::|:|:....|.|....:.:|.|...||:|.:.|.    |.:...|.|.:|:.|||.|.
plant    75 VSMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGSLDIRVAVGYALDIARAME 139

  Fly   238 YLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSA-AGTYAWMPP 301
            .||:.   .:||||||..::::       ....||:|:.|||||||...|:.|:| .|||.||.|
plant   140 CLHSH---GVIHRDLKPESLIL-------TADYKTVKLADFGLAREESLTEMMTAETGTYRWMAP 194

  Fly   302 EVISVST--------YSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCP 358
            |:.|..|        |:...|.:|:.::|||||..:.|::|...|..||..|...:. |.....|
plant   195 ELYSTVTLRHGEKKHYNHKVDAYSFAIVLWELIHNKLPFEGMSNLQAAYAAAFKNVR-PSADDLP 258

  Fly   359 ETWGALMKSCWQTDPHKRPGFKEILKQL-----------------ESIACSKFTLTPQES 401
            :....::.|||:.||:.||.|.||::.|                 :.:..|:.|:.|.||
plant   259 KDLAMIVTSCWKEDPNDRPNFTEIIQMLLRCLSTISSTELVPPAIKRVFSSENTVLPPES 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 92/282 (33%)
STKc_MLK 134..389 CDD:270963 90/297 (30%)
AT5G40540NP_198870.1 STKc_MAP3K-like 32..286 CDD:270901 88/265 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.