DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT5G01850

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001332324.1 Gene:AT5G01850 / 831760 AraportID:AT5G01850 Length:357 Species:Arabidopsis thaliana


Alignment Length:309 Identity:99/309 - (32%)
Similarity:151/309 - (48%) Gaps:53/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQ-RMRDNVLQEAKLFWALKHENIAALR 192
            |.|...||.|...||::|.|..:.||||:.::..:.|.| .:....::|..:...::|.|:..:.
plant    18 LFIGSKIGEGAHGKVYQGRYGRQIVAIKVVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKVS 82

  Fly   193 ------------------------GVCLNTKLCLVMEYARGGSLNRILAGKIPPDVL-----VNW 228
                                    |.|.:..:.:|.|...|.||.:.|. .|.|.:|     :::
plant    83 LLLSSLSLLSILLLEYTISIWQFIGACKDPLMVIVTELLPGMSLRKYLT-SIRPQLLHLPLALSF 146

  Fly   229 AIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSA- 292
            |:.|||.::.||..   .|||||||..|:|:.|    ||   |::|:.|||||||...|:.|:| 
plant   147 ALDIARALHCLHAN---GIIHRDLKPDNLLLTE----NH---KSVKLADFGLAREESVTEMMTAE 201

  Fly   293 AGTYAWMPPEVISVST--------YSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTL 349
            .|||.||.||:.|..|        |:...||:|:|::||||:|...|::|...|..||..|....
plant   202 TGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFKQE 266

  Fly   350 TLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSKFTLTP 398
            ...:|:....:...:::|||..||:.||.|.:|::.|....   .||||
plant   267 RPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLLNEFL---LTLTP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 94/295 (32%)
STKc_MLK 134..389 CDD:270963 93/293 (32%)
AT5G01850NP_001332324.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.