DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and CTR1

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_195993.1 Gene:CTR1 / 831748 AraportID:AT5G03730 Length:821 Species:Arabidopsis thaliana


Alignment Length:311 Identity:108/311 - (34%)
Similarity:159/311 - (51%) Gaps:22/311 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KIGDKVGVFPKDFVTDEDPLQLNVSSAIG-DIQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEE 152
            :..:::...|.:......|:....:..:| |....:|.:.:|:|||.||:|.|..|||..:.|.:
plant   510 RASNQIEAAPMNAPPISQPVPNRANRELGLDGDDMDIPWCDLNIKEKIGAGSFGTVHRAEWHGSD 574

  Fly   153 VAIKIAHQTGEDDMQRMRDN-VLQEAKLFWALKHENIAALRG-VCLNTKLCLVMEYARGGSLNRI 215
            ||:||..   |.|....|.| .|:|..:...|:|.||....| |.....|.:|.||...|||.|:
plant   575 VAVKILM---EQDFHAERVNEFLREVAIMKRLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLYRL 636

  Fly   216 LAGKIPPDVL-----VNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKI 275
            |......:.|     ::.|..:|:|||||||..| .|:||||||.|:|:.        ::.|:|:
plant   637 LHKSGAREQLDERRRLSMAYDVAKGMNYLHNRNP-PIVHRDLKSPNLLVD--------KKYTVKV 692

  Fly   276 TDFGLAREMYNT--QRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPL 338
            .||||:|...:|  ...|||||..||.|||:.....::.|||:|:||:||||.|.:.|:...:|.
plant   693 CDFGLSRLKASTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPA 757

  Fly   339 SVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESI 389
            .|...|......|.||:.......|:::.||..:|.|||.|..|:..|..:
plant   758 QVVAAVGFKCKRLEIPRNLNPQVAAIIEGCWTNEPWKRPSFATIMDLLRPL 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 1/14 (7%)
TyrKc 129..386 CDD:197581 102/265 (38%)
STKc_MLK 134..389 CDD:270963 99/263 (38%)
CTR1NP_195993.1 EDR1 208..413 CDD:291079
TyrKc 551..805 CDD:197581 102/265 (38%)
STKc_MAP3K-like 557..805 CDD:270901 98/259 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.