DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and STY46

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_568041.1 Gene:STY46 / 830003 AraportID:AT4G38470 Length:575 Species:Arabidopsis thaliana


Alignment Length:278 Identity:104/278 - (37%)
Similarity:150/278 - (53%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAH-QTGEDDMQRMRDNVLQEAKLFWALKHE 186
            ||....|.....|.||.:..:::|.|..:|||||:.. :..:.|:::   ...||..:...::|:
plant   284 EINLKHLKFGHKIASGSYGDLYKGTYCSQEVAIKVLKPERLDSDLEK---EFAQEVFIMRKVRHK 345

  Fly   187 NIAALRGVCLNTK---LCLVMEYARGGSLNRIL-----AGKIPPDVLVNWAIQIARGMNYLHNEA 243
            |:....|.|  ||   ||:|.|:..|||:...|     ..|:|  .|...||.|.:||:|||.. 
plant   346 NVVQFIGAC--TKPPHLCIVTEFMPGGSVYDYLHKQKGVFKLP--TLFKVAIDICKGMSYLHQN- 405

  Fly   244 PMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSA-AGTYAWMPPEVISVS 307
              :|||||||::|:|:.|        .:.:|:.|||:||....|..|:| .|||.||.||||...
plant   406 --NIIHRDLKAANLLMDE--------NEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHK 460

  Fly   308 TYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTD 372
            .|...:||:|||::||||:||:.||:...||..|.||....|...|||........|::..|:.|
plant   461 PYDHKADVFSYGIVLWELLTGKLPYEYMTPLQAAVGVVQKGLRPTIPKNTHPKLAELLERLWEHD 525

  Fly   373 PHKRPGFKEILKQLESIA 390
            ..:||.|.||::||:.||
plant   526 STQRPDFSEIIEQLQEIA 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 98/266 (37%)
STKc_MLK 134..389 CDD:270963 99/264 (38%)
STY46NP_568041.1 ACT 176..241 CDD:415594
STKc_MAP3K-like 296..539 CDD:270901 97/260 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1119
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.